Pay in 4 interest-free payments of $45.33 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
BS40214-100
Mutations in this gene cause different kinds of severe combined immunodeficiency disorders
12Z-octadecadienoate to 13-hydroperoxyoctadecadienoate/13-HPODE
a secreted protein that cooperates with Toll-like receptors (TLRs) in the response of macrophages to bacterial lipopolysaccharides (LPS) or cell wall components
HGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQY
Human Sp17 (Sperm Protein 17) ELISA Kit - RE1888H Control&Tag BS40214-100Human Sp17 (Sperm Protein 17) ELISA Kit Sizes: 48T, 96T Catalogue Numbers: RE1888H 48, RE1888H 96 Citations, Manuals and MSDS Available upon request. Species: Human Alternative Names: SPA17, CT22, SP17, SP17 1, sperm autoantigenic protein 17 Detection method: Sandwich Reaction time: 3. 5H Research Areas: Enzyme and Kinase; Sensitivity: 0. 1 ng mL Detection Range: 0. 16 10ng mL Sample Types: Serum, Plasma, Tissue homogenate and Other biological
US$ 168.00
US$ 168.00
US$ 138.00
US$ 169.00
US$ 184.50
US$ 59.95
US$ 184.50
US$ 138.95
US$ 112.50
US$ 38.40
US$ 168.00
US$ 56.00
US$ 35.96
US$ 128.00